Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dennd1a Rabbit Polyclonal Antibody (FITC)

Dennd1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Connecdenn, 6030446I19Rik

UniProt

Q8K382

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_666234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)
MBS1351604-01 0.02 mg (E-Coli)

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)
MBS1351604-02 0.02 mg (Yeast)

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)
MBS1351604-03 0.1 mg (E-Coli)

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)
MBS1351604-04 0.1 mg (Yeast)

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)
MBS1351604-05 0.02 mg (Baculovirus)

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)
MBS1351604-06 0.02 mg (Mammalian-Cell)

Recombinant Streptococcus mutans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details