Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA3 Rabbit Polyclonal Antibody (FITC)

GBA3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CBG, GLUC, KLRP, CBGL1

UniProt

Q9H227

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GBA3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUGBP1, NT (CELF1, BRUNOL2, CUGBP, CUGBP1, NAB50, CUGBP Elav-like family member 1, 50kD nuclear polyadenylated RNA-binding protein, Bruno-like protein 2, CUG triplet repeat RNA-binding protein 1, CUG-BP-and ETR-3-like factor 1, Deadenylation factor CUG-BP
MBS6290033-01 0.2 mL

CUGBP1, NT (CELF1, BRUNOL2, CUGBP, CUGBP1, NAB50, CUGBP Elav-like family member 1, 50kD nuclear polyadenylated RNA-binding protein, Bruno-like protein 2, CUG triplet repeat RNA-binding protein 1, CUG-BP-and ETR-3-like factor 1, Deadenylation factor CUG-BP

Sign In for Pricing
View Details
CUGBP1, NT (CELF1, BRUNOL2, CUGBP, CUGBP1, NAB50, CUGBP Elav-like family member 1, 50kD nuclear polyadenylated RNA-binding protein, Bruno-like protein 2, CUG triplet repeat RNA-binding protein 1, CUG-BP-and ETR-3-like factor 1, Deadenylation factor CUG-BP
MBS6290033-02 5x 0.2 mL

CUGBP1, NT (CELF1, BRUNOL2, CUGBP, CUGBP1, NAB50, CUGBP Elav-like family member 1, 50kD nuclear polyadenylated RNA-binding protein, Bruno-like protein 2, CUG triplet repeat RNA-binding protein 1, CUG-BP-and ETR-3-like factor 1, Deadenylation factor CUG-BP

Sign In for Pricing
View Details
GSK-3 Beta Recombinant Rabbit mAb, Cy3 conjugated
orb3164169 100 µL

GSK-3 Beta Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
HSP72 Mouse Monoclonal Antibody
orb1474047-01 30 µL

HSP72 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HSP72 Mouse Monoclonal Antibody
orb1474047-02 50 μL

HSP72 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HSP72 Mouse Monoclonal Antibody
orb1474047-03 100 µL

HSP72 Mouse Monoclonal Antibody

Sign In for Pricing
View Details