Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL7A Rabbit Polyclonal Antibody (HRP)

BCL7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BCL7

UniProt

Q4VC05

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BCL7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066273

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R14A (Protein Phosphatase 1 Regulatory Subunit 14A, 17kD PKC-potentiated Inhibitory Protein of PP1, Protein Kinase C-potentiated Inhibitor Protein of 17kD, CPI-17, CPI17, PPP1INL) (PE)
131688-PE 100 µL

PPP1R14A (Protein Phosphatase 1 Regulatory Subunit 14A, 17kD PKC-potentiated Inhibitory Protein of PP1, Protein Kinase C-potentiated Inhibitor Protein of 17kD, CPI-17, CPI17, PPP1INL) (PE)

Sign In for Pricing
View Details
Anti-Human HTRA4 Polyclonal Antibody
HD583014-01 50 µg

Anti-Human HTRA4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human HTRA4 Polyclonal Antibody
HD583014-02 100 µg

Anti-Human HTRA4 Polyclonal Antibody

Sign In for Pricing
View Details
Ammonium bifluoride 98%
A29944-01 25 g

Ammonium bifluoride 98%

Sign In for Pricing
View Details
Ammonium bifluoride 98%
A29944-02 100 g

Ammonium bifluoride 98%

Sign In for Pricing
View Details
Ammonium bifluoride 98%
A29944-03 500 g

Ammonium bifluoride 98%

Sign In for Pricing
View Details