Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufv2 Rabbit Polyclonal Antibody (HRP)

Ndufv2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2900010C23Rik

UniProt

Q9D6J6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Ndufv2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Spermatid maturation protein 1, SPEM1 ELISA Kit
MBS9327033-01 48 Well

Human Spermatid maturation protein 1, SPEM1 ELISA Kit

Sign In for Pricing
View Details
Human Spermatid maturation protein 1, SPEM1 ELISA Kit
MBS9327033-02 96 Well

Human Spermatid maturation protein 1, SPEM1 ELISA Kit

Sign In for Pricing
View Details
Human Spermatid maturation protein 1, SPEM1 ELISA Kit
MBS9327033-03 5x 96 Well

Human Spermatid maturation protein 1, SPEM1 ELISA Kit

Sign In for Pricing
View Details
Human Spermatid maturation protein 1, SPEM1 ELISA Kit
MBS9327033-04 10x 96 Well

Human Spermatid maturation protein 1, SPEM1 ELISA Kit

Sign In for Pricing
View Details
VTI1B Rabbit Polyclonal Antibody (FITC)
orb2095758 100 µL

VTI1B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (FITC)
137607-FITC 100 µL

Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (FITC)

Sign In for Pricing
View Details