Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp3cb Rabbit Polyclonal Antibody (FITC)

Ppp3cb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Calna2

UniProt

P20651

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ppp3cb

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058738

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD1 (Programmed Cell Death 1, Programmed Cell Death Protein 1, CD279, HGNC:8760, hPD-1, PD1, PD-1, Protein PD-1, SLEB2) (MaxLight 490)
MBS6254173-01 0.1 mL

PDCD1 (Programmed Cell Death 1, Programmed Cell Death Protein 1, CD279, HGNC:8760, hPD-1, PD1, PD-1, Protein PD-1, SLEB2) (MaxLight 490)

Sign In for Pricing
View Details
PDCD1 (Programmed Cell Death 1, Programmed Cell Death Protein 1, CD279, HGNC:8760, hPD-1, PD1, PD-1, Protein PD-1, SLEB2) (MaxLight 490)
MBS6254173-02 5x 0.1 mL

PDCD1 (Programmed Cell Death 1, Programmed Cell Death Protein 1, CD279, HGNC:8760, hPD-1, PD1, PD-1, Protein PD-1, SLEB2) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Nostoc sp. UPF0187 protein alr2987 (alr2987)
orb2915645-01 20 µg

Recombinant Nostoc sp. UPF0187 protein alr2987 (alr2987)

Sign In for Pricing
View Details
Recombinant Nostoc sp. UPF0187 protein alr2987 (alr2987)
orb2915645-02 100 µg

Recombinant Nostoc sp. UPF0187 protein alr2987 (alr2987)

Sign In for Pricing
View Details
Cryptosporidium sp. (MaxLight 750)
MBS6256910-01 0.1 mL

Cryptosporidium sp. (MaxLight 750)

Sign In for Pricing
View Details
Cryptosporidium sp. (MaxLight 750)
MBS6256910-02 5x 0.1 mL

Cryptosporidium sp. (MaxLight 750)

Sign In for Pricing
View Details