Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp3cb Rabbit Polyclonal Antibody (FITC)

Ppp3cb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Calna2

UniProt

P20651

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ppp3cb

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058738

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCGR2C, CT (CD32, CDw32, Fc-gamma RII-c, Fc-gamma-RIIc, FcRII-c, Low Affinity Immunoglobulin gamma Fc Region Receptor II-c, IgG Fc Receptor II-c, CD32, FCG2, IGFR2) (MaxLight 405)
MBS6475759-01 0.1 mL

FCGR2C, CT (CD32, CDw32, Fc-gamma RII-c, Fc-gamma-RIIc, FcRII-c, Low Affinity Immunoglobulin gamma Fc Region Receptor II-c, IgG Fc Receptor II-c, CD32, FCG2, IGFR2) (MaxLight 405)

Sign In for Pricing
View Details
FCGR2C, CT (CD32, CDw32, Fc-gamma RII-c, Fc-gamma-RIIc, FcRII-c, Low Affinity Immunoglobulin gamma Fc Region Receptor II-c, IgG Fc Receptor II-c, CD32, FCG2, IGFR2) (MaxLight 405)
MBS6475759-02 5x 0.1 mL

FCGR2C, CT (CD32, CDw32, Fc-gamma RII-c, Fc-gamma-RIIc, FcRII-c, Low Affinity Immunoglobulin gamma Fc Region Receptor II-c, IgG Fc Receptor II-c, CD32, FCG2, IGFR2) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Mgat3 qPCR Primer Pair
QM16986S 200 Tests

Mouse Mgat3 qPCR Primer Pair

Sign In for Pricing
View Details
Human Ankyrin repeat and SAM domain-containing protein 4B, ANKS4B ELISA Kit
MBS9334255-01 48 Well

Human Ankyrin repeat and SAM domain-containing protein 4B, ANKS4B ELISA Kit

Sign In for Pricing
View Details
Human Ankyrin repeat and SAM domain-containing protein 4B, ANKS4B ELISA Kit
MBS9334255-02 96 Well

Human Ankyrin repeat and SAM domain-containing protein 4B, ANKS4B ELISA Kit

Sign In for Pricing
View Details
Human Ankyrin repeat and SAM domain-containing protein 4B, ANKS4B ELISA Kit
MBS9334255-03 5x 96 Well

Human Ankyrin repeat and SAM domain-containing protein 4B, ANKS4B ELISA Kit

Sign In for Pricing
View Details