Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIB3 Rabbit Polyclonal Antibody (Biotin)

TRIB3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NIPK, SINK, TRB3, SKIP3, C20orf97

UniProt

Q96RU7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIB3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_066981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1PR2, CT (S1PR2, EDG5, Sphingosine 1-phosphate receptor 2, Endothelial differentiation G-protein coupled receptor 5, Sphingosine 1-phosphate receptor Edg-5) (Azide free) (HRP) discontinued
041364-HRP 200 µL

S1PR2, CT (S1PR2, EDG5, Sphingosine 1-phosphate receptor 2, Endothelial differentiation G-protein coupled receptor 5, Sphingosine 1-phosphate receptor Edg-5) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
FGG Mouse Monoclonal Antibody (APC)
orb2600431 100 µg

FGG Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
DLL1 (Delta-like Protein 1, Drosophila Delta Homolog 1, Delta1, H-Delta-1, UNQ146/PRO172) (MaxLight 650)
125886-ML650 100 µL

DLL1 (Delta-like Protein 1, Drosophila Delta Homolog 1, Delta1, H-Delta-1, UNQ146/PRO172) (MaxLight 650)

Sign In for Pricing
View Details
IGHM Protein Vector (Human) (pPB-N-His)
PV021046 500 ng

IGHM Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Bovine Serum Albumin-AF647 labled
BS22330-01 100 µL

Bovine Serum Albumin-AF647 labled

Sign In for Pricing
View Details
Bovine Serum Albumin-AF647 labled
BS22330-02 500 µL

Bovine Serum Albumin-AF647 labled

Sign In for Pricing
View Details