Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB40C Rabbit Polyclonal Antibody (HRP)

RAB40C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RARL, RASL8C

UniProt

Q6PIU5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB40C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MAdCAM1 (Mucosal Addressin Cell Adhesion Molecule 1) ELISA Kit
EM23252 96 Tests

Mouse MAdCAM1 (Mucosal Addressin Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit
MBS7202971-01 48 Well

Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit
MBS7202971-02 96 Well

Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit
MBS7202971-03 5x 96 Well

Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit
MBS7202971-04 10x 96 Well

Guinea pig Adenylate cyclase type 8 (ADCY8) ELISA Kit

Sign In for Pricing
View Details
PI3 Rabbit Polyclonal Antibody (FITC)
orb2118180 100 µL

PI3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details