Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOPH1 Rabbit Polyclonal Antibody (HRP)

ENOPH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E1, MASA, mtnC, MST145

UniProt

Q9UHY7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENOPH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human parainfluenza virus 4b (HPIV-4b) Hemagglutinin-neuraminidase Protein (aa 48-579, His Tag)
E45O55313I1-100 100 µg

Human parainfluenza virus 4b (HPIV-4b) Hemagglutinin-neuraminidase Protein (aa 48-579, His Tag)

Sign In for Pricing
View Details
LRRC26 Peptide
MBS3232442-01 0.1 mg

LRRC26 Peptide

Sign In for Pricing
View Details
LRRC26 Peptide
MBS3232442-02 5x 0.1 mg

LRRC26 Peptide

Sign In for Pricing
View Details
PER2 Human shRNA Lentiviral Particle (Locus ID 8864)
TL310503V 500 µL Each

PER2 Human shRNA Lentiviral Particle (Locus ID 8864)

Sign In for Pricing
View Details
NONO antibody
70R-18921 50 μL

NONO antibody

Sign In for Pricing
View Details
Recombinant Human SS18L1 Protein, N-GST & C-His
orb2830588-01 20 µg

Recombinant Human SS18L1 Protein, N-GST & C-His

Sign In for Pricing
View Details