Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOPH1 Rabbit Polyclonal Antibody (HRP)

ENOPH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E1, MASA, mtnC, MST145

UniProt

Q9UHY7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENOPH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-Smooth Muscle Actin Antibody [L19D14]
C18563-50uL 50 μL

α-Smooth Muscle Actin Antibody [L19D14]

Sign In for Pricing
View Details
TNF Receptor Superfamily Member 5 / TNFRSF5 (CD40) Antibody (PE)
abx414182 100 Tests

TNF Receptor Superfamily Member 5 / TNFRSF5 (CD40) Antibody (PE)

Sign In for Pricing
View Details
Anti-human B7-H1 / PD-L1 / CD274 (Sudubrilimab Biosimilar)
BIO0436SM-20mg 20 mg

Anti-human B7-H1 / PD-L1 / CD274 (Sudubrilimab Biosimilar)

Sign In for Pricing
View Details
Rabbit TRIM47/GOA Antibody
orb1528853-01 10 µL

Rabbit TRIM47/GOA Antibody

Sign In for Pricing
View Details
Rabbit TRIM47/GOA Antibody
orb1528853-02 100 µL

Rabbit TRIM47/GOA Antibody

Sign In for Pricing
View Details
Flnb (NM_001107288) Rat Untagged Clone
RN208458 10 µg

Flnb (NM_001107288) Rat Untagged Clone

Sign In for Pricing
View Details