Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOPH1 Rabbit Polyclonal Antibody (HRP)

ENOPH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E1, MASA, mtnC, MST145

UniProt

Q9UHY7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ENOPH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_067027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (rBP53-12), CF640R conjugate, 0.1mg/mL
BNC402094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sod1 Mouse Gene Knockout Kit (CRISPR)
KN516461 1 Kit

Sod1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ɑ-Amino-ω-Boc Amino PEG
133000-20-21.500MG 500 mg

Ɑ-Amino-ω-Boc Amino PEG

Sign In for Pricing
View Details
Zfyve9 Mouse Gene Knockout Kit (CRISPR)
KN520075 1 Kit

Zfyve9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Timeless activation kit by CRISPRa
GA204351 1 Kit

Mouse Timeless activation kit by CRISPRa

Sign In for Pricing
View Details
Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF594 conjugate, 0.1mg/mL
BNC942190-500 1x 500 µL

Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details