Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGD Rabbit Polyclonal Antibody (HRP)

RRAGD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAGD, bA11D8.2.1

UniProt

Q9NQL2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RRAGD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaM II shRNA (m) Lentiviral Particles
sc-141988-V 200 µL

CaM II shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Bpifa2f sgRNA CRISPR Lentivector (Rat) (Target 3)
K7605704 1.0 µg DNA

Bpifa2f sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
MTBP (NM_022045) Human Over-expression Lysate
LS027085-20ug 20 µg

MTBP (NM_022045) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Rat C3a Receptor, PE (Clone 74) (mouse IgG1)
MBS520596-01 0.05 mg

Anti-Rat C3a Receptor, PE (Clone 74) (mouse IgG1)

Sign In for Pricing
View Details
Anti-Rat C3a Receptor, PE (Clone 74) (mouse IgG1)
MBS520596-02 5x 0.05 mg

Anti-Rat C3a Receptor, PE (Clone 74) (mouse IgG1)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 11 (FGF11) ELISA Kit
RDR-FGF11-Ra-96Tests 96 Tests

Rat Fibroblast Growth Factor 11 (FGF11) ELISA Kit

Sign In for Pricing
View Details