Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHA1 Rabbit Polyclonal Antibody (Biotin)

PLEKHA1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TAPP1

UniProt

Q9HB21

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067635

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pex6 (NM_057125) Rat Tagged Lenti ORF Clone
RR203832L3 10 µg

Pex6 (NM_057125) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Os02g0149800 Antibody
orb840410 2 mg

Os02g0149800 Antibody

Sign In for Pricing
View Details
JNK3 Rabbit pAb
E45R23694N-100 100 µL

JNK3 Rabbit pAb

Sign In for Pricing
View Details
PHAPI2 (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, Acidic Protein Rich in Leucines, Putative HLA-DR-associated Protein I-2, ANP32B, Silver-stainable Protein SSP29, APRIL)
MBS648902-01 0.1 mg

PHAPI2 (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, Acidic Protein Rich in Leucines, Putative HLA-DR-associated Protein I-2, ANP32B, Silver-stainable Protein SSP29, APRIL)

Sign In for Pricing
View Details
PHAPI2 (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, Acidic Protein Rich in Leucines, Putative HLA-DR-associated Protein I-2, ANP32B, Silver-stainable Protein SSP29, APRIL)
MBS648902-02 5x 0.1 mg

PHAPI2 (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, Acidic Protein Rich in Leucines, Putative HLA-DR-associated Protein I-2, ANP32B, Silver-stainable Protein SSP29, APRIL)

Sign In for Pricing
View Details
ENOX2 Polyclonal Antibody
E-AB-67816-01 60 µL

ENOX2 Polyclonal Antibody

Sign In for Pricing
View Details