Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP2 Rabbit Polyclonal Antibody (HRP)

SENP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AXAM2, SMT3IP2

UniProt

Q9HC62

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SENP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Heparan Sulfate (HS) ELISA Kit-Competitive
EK1F624 96 Tests

Bovine Heparan Sulfate (HS) ELISA Kit-Competitive

Sign In for Pricing
View Details
Human TNN knockout cell line
ABC-KH15874 1 Vial

Human TNN knockout cell line

Sign In for Pricing
View Details
ECF506 100mg
A13126-100 100 mg

ECF506 100mg

Sign In for Pricing
View Details
PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (FITC)
MBS6148896-01 0.1 mL

PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (FITC)

Sign In for Pricing
View Details
PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (FITC)
MBS6148896-02 5x 0.1 mL

PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (FITC)

Sign In for Pricing
View Details
Human Cathepsin G (CG) AssayLite™ Antibody (APC Conjugate)
11654-05061 5x 30 µg

Human Cathepsin G (CG) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details