Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP26 Rabbit Polyclonal Antibody (HRP)

MMP26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC126590, MGC126592

UniProt

Q9NRE1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MMP26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_068573

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLI4 Peptide - N-terminal region (AAP36136)
AAP36136-100UG 100 µg

GLI4 Peptide - N-terminal region (AAP36136)

Sign In for Pricing
View Details
LRRC34 Human qPCR Primer Pair (NM_153353)
HP218124 200 Reactions

LRRC34 Human qPCR Primer Pair (NM_153353)

Sign In for Pricing
View Details
TEC Polyclonal Antibody, PE-Cy7 Conjugated
bs-15505R-PE-Cy7 100 µL

TEC Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral human ADAMTS12 shRNA (UAS) - Lentiviral human ADAMTS12 shRNA (UAS, GFP) plasmid
GTR15109702 1 Vial

Lentiviral human ADAMTS12 shRNA (UAS) - Lentiviral human ADAMTS12 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human RTN4RL2 shRNA (UAS) - Lentiviral human RTN4RL2 shRNA (UAS) (25)
GTR15159077 1 Vial

Lentiviral human RTN4RL2 shRNA (UAS) - Lentiviral human RTN4RL2 shRNA (UAS) (25)

Sign In for Pricing
View Details
MGAM Rabbit pAb
A17584-01 20 µL

MGAM Rabbit pAb

Sign In for Pricing
View Details