Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIC8A Rabbit Polyclonal Antibody (HRP)

RIC8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIC8

UniProt

Q9NPQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RIC8A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068751

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPING1, ID (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, C1NH, C1IN) (Biotin) discontinued
S1000-78G2-Biotin 200 µL

SERPING1, ID (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, C1NH, C1IN) (Biotin) discontinued

Sign In for Pricing
View Details
B And T-Lymphocyte Attenuator (BTLA) Polyclonal Antibody
CAU25437-01 100 µL

B And T-Lymphocyte Attenuator (BTLA) Polyclonal Antibody

Sign In for Pricing
View Details
B And T-Lymphocyte Attenuator (BTLA) Polyclonal Antibody
CAU25437-02 200 µL

B And T-Lymphocyte Attenuator (BTLA) Polyclonal Antibody

Sign In for Pricing
View Details
B And T-Lymphocyte Attenuator (BTLA) Polyclonal Antibody
CAU25437-03 1 mL

B And T-Lymphocyte Attenuator (BTLA) Polyclonal Antibody

Sign In for Pricing
View Details
Olr1105 (NM_001001078) Rat Tagged Lenti ORF Clone
RR211634L4 10 µg

Olr1105 (NM_001001078) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD73 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb874121 100 µL

CD73 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details