Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS22 Rabbit Polyclonal Antibody (FITC)

PRSS22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BSSP-4, SP001LA, hBSSP-4

UniProt

Q9GZN4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS22

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_071402

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Methylumbelliferyl 2-acetamido-2-deoxy-3-O- (α-L-fucopyranosyl) -β-D-glucopyranoside
M4110 1 mg

4-Methylumbelliferyl 2-acetamido-2-deoxy-3-O- (α-L-fucopyranosyl) -β-D-glucopyranoside

Sign In for Pricing
View Details
Fish EH Domain-Containing Protein 3 (EHD3) ELISA Kit
MBS9396903 Inquire

Fish EH Domain-Containing Protein 3 (EHD3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal Ret Antibody (009) [mFluor Violet 610 SE]
NBP2-90038MFV610 0.1 mL

Rabbit Monoclonal Ret Antibody (009) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Plant Golgi Protein 73 (GP73) ELISA Kit
MBS9378379 Inquire

Plant Golgi Protein 73 (GP73) ELISA Kit

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup B NADH-quinone oxidoreductase subunit L (nuoL), partial
MBS7099792 Inquire

Recombinant Neisseria meningitidis serogroup B NADH-quinone oxidoreductase subunit L (nuoL), partial

Sign In for Pricing
View Details
Porcine D-Lactate Dehydrogenase D-LDH ELISA Kit
BG-POR10810 1 Each

Porcine D-Lactate Dehydrogenase D-LDH ELISA Kit

Sign In for Pricing
View Details