Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVG Rabbit Polyclonal Antibody (FITC)

PARVG Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9HBI0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARVG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322) (MaxLight 550)
MBS6383758-01 0.1 mL

KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322) (MaxLight 550)

Sign In for Pricing
View Details
KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322) (MaxLight 550)
MBS6383758-02 5x 0.1 mL

KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human SGK2, N-His
ARO-P13093-01 50 µg

Recombinant Human SGK2, N-His

Sign In for Pricing
View Details
Recombinant Human SGK2, N-His
ARO-P13093-02 100 µg

Recombinant Human SGK2, N-His

Sign In for Pricing
View Details
Recombinant Human SGK2, N-His
ARO-P13093-03 1 mg

Recombinant Human SGK2, N-His

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Protein TusC (tusC)
MBS1096057-01 0.02 mg (E-Coli)

Recombinant Salmonella enteritidis PT4 Protein TusC (tusC)

Sign In for Pricing
View Details