Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVG Rabbit Polyclonal Antibody (HRP)

PARVG Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9HBI0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARVG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit MTHFD1 Antibody
orb1521369-01 10 µL

Rabbit MTHFD1 Antibody

Sign In for Pricing
View Details
Rabbit MTHFD1 Antibody
orb1521369-02 100 µL

Rabbit MTHFD1 Antibody

Sign In for Pricing
View Details
Olfr474 Protein Vector (Mouse) (pPM-C-His)
PV210605 500 ng

Olfr474 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RIPK3 Blocking Peptide
abx161414-01 1 mg

RIPK3 Blocking Peptide

Sign In for Pricing
View Details
RIPK3 Blocking Peptide
abx161414-02 5 mg

RIPK3 Blocking Peptide

Sign In for Pricing
View Details
Transmembrane protein 211 (TMEM211) (NM_001001663) Human Untagged Clone
SC300249 10 µg

Transmembrane protein 211 (TMEM211) (NM_001001663) Human Untagged Clone

Sign In for Pricing
View Details