Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fn3k Rabbit Polyclonal Antibody (FITC)

Fn3k Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fnsk

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fn3k

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001102521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (5-20ug) labeling
#92412 1 Kit

Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP620606 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
Mouse Krt17 activation kit by CRISPRa
GA202371 1 Kit

Mouse Krt17 activation kit by CRISPRa

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G7]
TA505946BM 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G7]

Sign In for Pricing
View Details
Annexin VIII (ANXA8) (NM_001040084) Human Recombinant Protein
TP720185L 500 µg

Annexin VIII (ANXA8) (NM_001040084) Human Recombinant Protein

Sign In for Pricing
View Details
Rps20 Mouse Gene Knockout Kit (CRISPR)
KN515090 1 Kit

Rps20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details