Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fn3k Rabbit Polyclonal Antibody (FITC)

Fn3k Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fnsk

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fn3k

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001102521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Goat Affinity Purified Antibody to Human IgG
RAF-001-2 2 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human IgG

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF640R conjugate, 0.1mg/mL
BNC402125-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CA5A/CA-VA Protein (His Tag)
PKSH031568 50 µg

Recombinant Human CA5A/CA-VA Protein (His Tag)

Sign In for Pricing
View Details
Slc25a20 Mouse Gene Knockout Kit (CRISPR)
KN515966 1 Kit

Slc25a20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-nitroso rac Sulpiride
TRC-N574390-100MG 100 mg

N-nitroso rac Sulpiride

Sign In for Pricing
View Details
BRMS1 (NM_001024957) Human Over-expression Lysate
LY422568 100 µg

BRMS1 (NM_001024957) Human Over-expression Lysate

Sign In for Pricing
View Details