Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Necab1 Rabbit Polyclonal Antibody (Biotin)

Necab1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

STI, NECA, Efcbp, Efcbp1, STIP-1, 1700003H21Rik

UniProt

Q8BG18

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)
MBS2062634-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)
MBS2062634-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)
MBS2062634-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)
MBS2062634-04 1 mL

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)
MBS2062634-05 5 mL

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)
MBS2062634-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Platelet Derived Growth Factor Receptor Alpha (PDGFRa)

Sign In for Pricing
View Details