Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBL Rabbit Polyclonal Antibody (Biotin)

GBL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GBL, LST8, POP3, WAT1, GbetaL

UniProt

Q9BVC4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GBL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_071767

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ATP Citrate Synthase (Thr447/Ser451) Rabbit mAb, 1 pack = 100 µL
BAL2243 1 Each

Phospho-ATP Citrate Synthase (Thr447/Ser451) Rabbit mAb, 1 pack = 100 µL

Sign In for Pricing
View Details
PTP alpha (PTPRA) (NM_080840) Human Over-expression Lysate
LC409009 20 µg

PTP alpha (PTPRA) (NM_080840) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Pdzk1ip1 activation kit by CRISPRa
GA207187 1 Kit

Mouse Pdzk1ip1 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2092160-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2092160-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2092160-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details