Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-2-glycoprotein 1 (APOH), partial

Product Specifications

Product Name Alternative

(APC inhibitor) (Activated protein C-binding protein) (Anticardiolipin cofactor) (Apolipoprotein H) (Apo-H) (Beta-2-glycoprotein I) (B2GPI) (Beta (2) GPI)

Abbreviation

Recombinant Human APOH protein, partial

Gene Name

APOH

UniProt

P02749

Expression Region

119-345aa

Organism

Homo sapiens (Human)

Target Sequence

ADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.8 kDa

References & Citations

"Purification of apolipoprotein H (beta 2-glycoprotein I) -like protein from human follicular fluid." Aleporou-Marinou V., Pappa H., Yalouris P., Patargias T. Comp. Biochem. Physiol. 128B:537-542 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 650)
M3007-13-ML650 100 µL

C-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 650)

Sign In for Pricing
View Details
(Rac) -Antineoplaston A10
C07283-5mg 5 mg

(Rac) -Antineoplaston A10

Sign In for Pricing
View Details
Human CRYGD Knockout HEK293T cell line
GTR15403302 1 Vial

Human CRYGD Knockout HEK293T cell line

Sign In for Pricing
View Details
TIMM23 Rabbit Polyclonal Antibody (Cy5.5)
orb1067407 100 µL

TIMM23 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Genorise® Bovine (cattle) TGF-beta 2 polyclonal antibody
GR105077 100 µg

Genorise® Bovine (cattle) TGF-beta 2 polyclonal antibody

Sign In for Pricing
View Details
Protein phosphatase 1, regulatory (Inhibitor) subunit 14A
330959 100 µL

Protein phosphatase 1, regulatory (Inhibitor) subunit 14A

Sign In for Pricing
View Details