Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS52 Rabbit Polyclonal Antibody (HRP)

VPS52 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARE1, SAC2, SACM2L, dJ1033B10.5

UniProt

Q8N1B4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human VPS52

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_072047

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO1 Rabbit Polyclonal Antibody (PE)
orb2454987 100 µL

RSPO1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit
MBS2021113-01 24 Strip Well

Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit
MBS2021113-02 48 Well

Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit
MBS2021113-03 96 Well

Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit
MBS2021113-04 5x 96 Well

Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit
MBS2021113-05 10x 96 Well

Mouse Tripeptidyl Peptidase I (TPP1) ELISA Kit

Sign In for Pricing
View Details