Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acbd3 Rabbit Polyclonal Antibody (HRP)

Acbd3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7TNY6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_878263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTMA (Prothymosin alpha) ELISA Kit
EKF57384 96 Tests

Human PTMA (Prothymosin alpha) ELISA Kit

Sign In for Pricing
View Details
Human Bromodomain-containing protein 8, BRD8 ELISA KIT
ELI-49291h 96 Tests

Human Bromodomain-containing protein 8, BRD8 ELISA KIT

Sign In for Pricing
View Details
GPR35 CRISPR/Cas9 KO Plasmid (m)
sc-425672 20 µg

GPR35 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Apol10a 3'UTR Luciferase Stable Cell Line
TU101970 1.0 mL

Apol10a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Plcd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4662203 1.0 µg DNA

Plcd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Amino (4-methanesulfonylphenyl) acetic acid
441373-01 25 mg

Amino (4-methanesulfonylphenyl) acetic acid

Sign In for Pricing
View Details