Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acbd3 Rabbit Polyclonal Antibody (HRP)

Acbd3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7TNY6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_878263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCF2 (NM_000433) Human Over-expression Lysate
LY400154 100 µg

NCF2 (NM_000433) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant human Microtubule-associated protein 1S
OPCA00995-100UG 100 µg

Recombinant human Microtubule-associated protein 1S

Sign In for Pricing
View Details
Recombinant Human FCER1G, GST-tagged
FCER1G-12816H 25 µg

Recombinant Human FCER1G, GST-tagged

Sign In for Pricing
View Details
RPS24 (NM_001026) Human Tagged ORF Clone Lentiviral Particle
RC224106L3V 200 µL

RPS24 (NM_001026) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DCX (Doublecortin, DBCN, DC, LISX, SCLH, XLIS) (FITC)
245230-FITC 100 µL

DCX (Doublecortin, DBCN, DC, LISX, SCLH, XLIS) (FITC)

Sign In for Pricing
View Details
Conjugated AMPK alpha 2 (Phospho-S345) Rabbit mAb
C13424 100 µL

Conjugated AMPK alpha 2 (Phospho-S345) Rabbit mAb

Sign In for Pricing
View Details