Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATPAF1 Rabbit Polyclonal Antibody (FITC)

ATPAF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATP11, ATP11p

UniProt

Q5TC12

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATPAF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIC Polyclonal Antibody, FITC Conjugated
A61128-050 50 µL

SPIC Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)
abx315321-01 20 µg

Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)

Sign In for Pricing
View Details
Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)
abx315321-02 50 µg

Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)

Sign In for Pricing
View Details
Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)
abx315321-03 100 µg

Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)

Sign In for Pricing
View Details
Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)
abx315321-04 200 µg

Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)

Sign In for Pricing
View Details
Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)
abx315321-05 1 mg

Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF2 / SLC9A3R2 (NHERF2) Antibody (FITC)

Sign In for Pricing
View Details