Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATPAF1 Rabbit Polyclonal Antibody (HRP)

ATPAF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATP11, ATP11p

UniProt

Q5TC12

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATPAF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf223 (TEX38) activation kit by CRISPRa
GA117798 1 Kit

Human C1orf223 (TEX38) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human NCF2/P67phox Protein (His & GST Tag)
PKSH030528 50 µg

Recombinant Human NCF2/P67phox Protein (His & GST Tag)

Sign In for Pricing
View Details
TentaGel® HL NH₂
HL12162.1G 1 g

TentaGel® HL NH₂

Sign In for Pricing
View Details
Human ZNF545 (ZFP82) activation kit by CRISPRa
GA117144 1 Kit

Human ZNF545 (ZFP82) activation kit by CRISPRa

Sign In for Pricing
View Details
Melanophilin (mLPH) (NM_024101) Human Over-expression Lysate
LC402978 20 µg

Melanophilin (mLPH) (NM_024101) Human Over-expression Lysate

Sign In for Pricing
View Details
EDANS sodium salt [5- ((2-Aminoethyl) aminonaphthalene-1-sulfonic acid, sodium salt] *CAS 100900-07-0*
615-AAT 1 g

EDANS sodium salt [5- ((2-Aminoethyl) aminonaphthalene-1-sulfonic acid, sodium salt] *CAS 100900-07-0*

Sign In for Pricing
View Details