Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPPK Rabbit Polyclonal Antibody (Biotin)

IPPK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IP5K, IPK1, C9orf12, INSP5K2, bA476B13.1

UniProt

Q9H8X2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IPPK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit
MBS9328163-01 48 Well

Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit

Sign In for Pricing
View Details
Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit
MBS9328163-02 96 Well

Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit

Sign In for Pricing
View Details
Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit
MBS9328163-03 5x 96 Well

Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit

Sign In for Pricing
View Details
Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit
MBS9328163-04 10x 96 Well

Human Choline-phosphate cytidylyltransferase B, PCYT1B ELISA Kit

Sign In for Pricing
View Details
Lentiviral human KCNJ8 shRNA (UAS) - Lentiviral human KCNJ8 shRNA (UAS, GFP) plasmid
GTR15094786 1 Vial

Lentiviral human KCNJ8 shRNA (UAS) - Lentiviral human KCNJ8 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
HMBS (HEM3, HMBS, Hydroxymethylbilane Synthase, PBG D, PBG-D, PBGD, Porphobilinogen Deaminase, Pre uroporphyrinogen Synthase, Pre-uroporphyrinogen Synthase, UPS, Uroporphyrinogen I Synthase, Uroporphyrinogen I Synthetase) discontinued
223313-01 50 µL

HMBS (HEM3, HMBS, Hydroxymethylbilane Synthase, PBG D, PBG-D, PBGD, Porphobilinogen Deaminase, Pre uroporphyrinogen Synthase, Pre-uroporphyrinogen Synthase, UPS, Uroporphyrinogen I Synthase, Uroporphyrinogen I Synthetase) discontinued

Sign In for Pricing
View Details