Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPPK Rabbit Polyclonal Antibody (HRP)

IPPK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IP5K, IPK1, C9orf12, INSP5K2, bA476B13.1

UniProt

Q9H8X2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IPPK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA810948S 30 µL

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI2G4]

Sign In for Pricing
View Details
AGPAT9 Antibody
43137 100 µL

AGPAT9 Antibody

Sign In for Pricing
View Details
PPIE CRISPR Knock Out 293T Cell Line (Human)
37359141 1x 10^6 Cells / 1.0 mL

PPIE CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human ATF6 CRISPR Knock Out HEK293S Cell Line-T1-13
T9352 1x106 cells / 1.0 mL

Human ATF6 CRISPR Knock Out HEK293S Cell Line-T1-13

Sign In for Pricing
View Details
Polyclonal OMG Antibody (internal region)
AMM06901G 0.1 mg

Polyclonal OMG Antibody (internal region)

Sign In for Pricing
View Details
Armcx1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6324404 1.0 µg DNA

Armcx1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details