Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPPK Rabbit Polyclonal Antibody (HRP)

IPPK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IP5K, IPK1, C9orf12, INSP5K2, bA476B13.1

UniProt

Q9H8X2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IPPK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (AP)
MBS6451751-01 0.1 mL

TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (AP)

Sign In for Pricing
View Details
TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (AP)
MBS6451751-02 5x 0.1 mL

TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (AP)

Sign In for Pricing
View Details
OVA sIgG (Ovalbumin Specific IgG) Human ELISA Kit
F6181 96 Tests

OVA sIgG (Ovalbumin Specific IgG) Human ELISA Kit

Sign In for Pricing
View Details
NR1I2 Rabbit Polyclonal Antibody (HRP)
orb2127245 100 µL

NR1I2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TRUSS Overexpression Lysate (Native) - (Dry Ice)
NBL1-17333 0.1 mg

TRUSS Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
mouse Monoclonal QPRT Antibody (24C4)
NBP2-59433-100ul 100 µL

mouse Monoclonal QPRT Antibody (24C4)

Sign In for Pricing
View Details