Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ippk Rabbit Polyclonal Antibody (HRP)

Ippk Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

InsP6, 1810043M15Rik

UniProt

Q6P1C1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_951011

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYLIP Antibody
OACA08781-50UL 50 µL

MYLIP Antibody

Sign In for Pricing
View Details
PTRHD1 Rabbit Polyclonal Antibody (BF594)
orb2417452 100 µL

PTRHD1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rabbit Polyclonal WDR26 Antibody [DyLight 488]
NBP1-26630G 0.1 mL

Rabbit Polyclonal WDR26 Antibody [DyLight 488]

Sign In for Pricing
View Details
ELISA Kit for Dickkopf Related Protein 4 (DKK4)
TRV-0052254-01 24 Tests

ELISA Kit for Dickkopf Related Protein 4 (DKK4)

Sign In for Pricing
View Details
ELISA Kit for Dickkopf Related Protein 4 (DKK4)
TRV-0052254-02 48 Tests

ELISA Kit for Dickkopf Related Protein 4 (DKK4)

Sign In for Pricing
View Details
ELISA Kit for Dickkopf Related Protein 4 (DKK4)
TRV-0052254-03 96 Tests

ELISA Kit for Dickkopf Related Protein 4 (DKK4)

Sign In for Pricing
View Details