Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATN2 Rabbit Polyclonal Antibody (Biotin)

MATN2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A8K106

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MATN2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_085072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXRB (Retinoid X Receptor, beta, DAUDI6, H-2RIIBP, MGC1831, NR2B2, RCoR-1) (MaxLight 405) discontinued
251363-ML405 100 µL

RXRB (Retinoid X Receptor, beta, DAUDI6, H-2RIIBP, MGC1831, NR2B2, RCoR-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal LRRK2 [p Ser935] Antibody (SR1453)
NBP3-21519-100ul 100 µL

Rabbit Monoclonal LRRK2 [p Ser935] Antibody (SR1453)

Sign In for Pricing
View Details
CEP135 Rabbit Polyclonal Antibody (AP)
orb919345 100 µL

CEP135 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H+L) Unconjugated
orb670231-01 100 µL

Goat Anti-Mouse IgG (H+L) Unconjugated

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H+L) Unconjugated
orb670231-02 500 μL

Goat Anti-Mouse IgG (H+L) Unconjugated

Sign In for Pricing
View Details
Human Epidermal growth factor Like Domain Protein, Multiple 7, EGFL7 ELISA Kit
MBS1606170-01 48 Well

Human Epidermal growth factor Like Domain Protein, Multiple 7, EGFL7 ELISA Kit

Sign In for Pricing
View Details