Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATN2 Rabbit Polyclonal Antibody (FITC)

MATN2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A8K106

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MATN2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_085072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GRB7 Rabbit mAb
E38MA4678 100 µL

Recombinant GRB7 Rabbit mAb

Sign In for Pricing
View Details
SLC7A3 Human Over-expression Lysate
orb1364407 20 µg

SLC7A3 Human Over-expression Lysate

Sign In for Pricing
View Details
GST (7I1) Mouse Monoclonal Antibody
E28PB2766 100 µL

GST (7I1) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ubac1 shRNA (UAS) - Lentiviral mouse Ubac1 shRNA (UAS) plasmid
GTR15250999 1 Vial

Lentiviral mouse Ubac1 shRNA (UAS) - Lentiviral mouse Ubac1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CENPE, CT (CENPE, Centromere-associated protein E, Centromere protein E, Kinesin-related protein CENPE) (MaxLight 550)
MBS6285091-01 0.1 mL

CENPE, CT (CENPE, Centromere-associated protein E, Centromere protein E, Kinesin-related protein CENPE) (MaxLight 550)

Sign In for Pricing
View Details
CENPE, CT (CENPE, Centromere-associated protein E, Centromere protein E, Kinesin-related protein CENPE) (MaxLight 550)
MBS6285091-02 5x 0.1 mL

CENPE, CT (CENPE, Centromere-associated protein E, Centromere protein E, Kinesin-related protein CENPE) (MaxLight 550)

Sign In for Pricing
View Details