Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB3 Rabbit Polyclonal Antibody (HRP)

NECAB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NIP1, XB51, STIP3, EFCBP3, SYTIP2, APBA2BP, dJ63M2.4, dJ63M2.5

UniProt

Q96P71

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NECAB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBL Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2413211 100 µL

CBL Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
PSMD14 3'UTR GFP Stable Cell Line
TU069082 1.0 mL

PSMD14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HEPES Plant Culture Tested
PCT1532-250G 250 g

HEPES Plant Culture Tested

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (EGFr) (Biotin) discontinued
E3375-30-Biotin 100 µL

Epidermal Growth Factor Receptor (EGFr) (Biotin) discontinued

Sign In for Pricing
View Details
Mnk1 Antibody
DF7763-01 100 µL

Mnk1 Antibody

Sign In for Pricing
View Details
Mnk1 Antibody
DF7763-02 200 µL

Mnk1 Antibody

Sign In for Pricing
View Details