Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3A Rabbit Polyclonal Antibody (Biotin)

PPP4R3A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Smk1, FLFL1, PP4R3, SMEK1, smk-1, PP4R3A, MSTP033, KIAA2010

UniProt

Q6IN85

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMEK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pBluescriptR-LINC00305 Plasmid
PVT21294 2 µg

pBluescriptR-LINC00305 Plasmid

Sign In for Pricing
View Details
ZBTB7B (Zinc Finger and BTB Domain-containing Protein 7B, Krueppel-related Zinc Finger Protein cKrox, hcKrox, T-helper-inducing POZ/Krueppel-like Factor, Zinc Finger and BTB Domain-containing Protein 15, Zinc Finger Protein 67 Homolog, Zfp-67, Zinc Finger Protein 857B, Zinc Finger Protein Th-POK, ZBTB15, ZFP67, ZNF857B) discontinued
Z0737-67C 50 µL

ZBTB7B (Zinc Finger and BTB Domain-containing Protein 7B, Krueppel-related Zinc Finger Protein cKrox, hcKrox, T-helper-inducing POZ/Krueppel-like Factor, Zinc Finger and BTB Domain-containing Protein 15, Zinc Finger Protein 67 Homolog, Zfp-67, Zinc Finger Protein 857B, Zinc Finger Protein Th-POK, ZBTB15, ZFP67, ZNF857B) discontinued

Sign In for Pricing
View Details
ALPI 3'UTR Luciferase Stable Cell Line
TU000659 1.0 mL

ALPI 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human/Mouse/Rat Akt1 Affinity Purified Polyclonal Ab
AF1775 50 µg

Human/Mouse/Rat Akt1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
DIRAS2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0603607 1.0 µg DNA

DIRAS2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CD21 Rabbit mAb
C06078-20uL 20 µL

CD21 Rabbit mAb

Sign In for Pricing
View Details