Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3A Rabbit Polyclonal Antibody (HRP)

PPP4R3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Smk1, FLFL1, PP4R3, SMEK1, smk-1, PP4R3A, MSTP033, KIAA2010

UniProt

Q6IN85

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMEK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agtr1b Mouse Gene Knockout Kit (CRISPR)
KN501000 1 Kit

Agtr1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF740 conjugate, 0.1mg/mL
BNC740418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lithocholic Acid 24-Ac-O-beta-D-Glucuronide
TRC-L469195-2MG 2 mg

Lithocholic Acid 24-Ac-O-beta-D-Glucuronide

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody [Clone ID: 3B2/TA8]
AM26145PU-N 100 µg

CD99 Mouse Monoclonal Antibody [Clone ID: 3B2/TA8]

Sign In for Pricing
View Details
Bis(2-chloroethyl) Ether(1,1'-Oxybis[2-chloro-ethane])
TRC-O870525-5G 5 g

Bis(2-chloroethyl) Ether(1,1'-Oxybis[2-chloro-ethane])

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB541721 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details