Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR2C Rabbit Polyclonal Antibody (FITC)

POLR2C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RPB3, RPB31, hRPB33, hsRPB3

UniProt

P19387

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse POLR2C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116558.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHN1 (N-chimaerin, A-chimaerin, Alpha-chimerin, N-chimerin, NC, Rho GTPase-activating Protein 2, ARHGAP2, CHN) (FITC)
MBS6373920-01 0.1 mL

CHN1 (N-chimaerin, A-chimaerin, Alpha-chimerin, N-chimerin, NC, Rho GTPase-activating Protein 2, ARHGAP2, CHN) (FITC)

Sign In for Pricing
View Details
CHN1 (N-chimaerin, A-chimaerin, Alpha-chimerin, N-chimerin, NC, Rho GTPase-activating Protein 2, ARHGAP2, CHN) (FITC)
MBS6373920-02 5x 0.1 mL

CHN1 (N-chimaerin, A-chimaerin, Alpha-chimerin, N-chimerin, NC, Rho GTPase-activating Protein 2, ARHGAP2, CHN) (FITC)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 3 (DAPK3)
TRV-0013183-01 10 µg

Recombinant Death Associated Protein Kinase 3 (DAPK3)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 3 (DAPK3)
TRV-0013183-02 50 µg

Recombinant Death Associated Protein Kinase 3 (DAPK3)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 3 (DAPK3)
TRV-0013183-03 100 µg

Recombinant Death Associated Protein Kinase 3 (DAPK3)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 3 (DAPK3)
TRV-0013183-04 200 µg

Recombinant Death Associated Protein Kinase 3 (DAPK3)

Sign In for Pricing
View Details