Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp4r4 Rabbit Polyclonal Antibody (Biotin)

Ppp4r4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MKIAA1622, 8430415E04Rik

UniProt

Q8C0Y0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083256

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)
TRV-0063725-01 24 Tests

Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)
TRV-0063725-02 48 Tests

Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)
TRV-0063725-03 96 Tests

Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)
TRV-0063725-04 5x 96 Tests

Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)
TRV-0063725-05 10x 96 Tests

Low Sample Volume ELISA Kit for Interleukin 12B (IL12B)

Sign In for Pricing
View Details
RON Antibody
AF6620-01 100 µL

RON Antibody

Sign In for Pricing
View Details