Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51L1 Rabbit Polyclonal Antibody (HRP)

RAD51L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

REC2, R51H2, RAD51L1

UniProt

O15315

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF5 Rabbit Polyclonal Antibody
TA366458 100 µL

ELF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNP Goat Anti-Llama IgG (H+L)
#20983-1mg 1x 1 mg

DNP Goat Anti-Llama IgG (H+L)

Sign In for Pricing
View Details
16S V3-V4 Library Preparation Kit for Illumina
70400 24 Preparations

16S V3-V4 Library Preparation Kit for Illumina

Sign In for Pricing
View Details
Transmembrane protein 132A Rabbit Polyclonal Antibody
0903-8 100 µL

Transmembrane protein 132A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Basic Water Purification System BBPS-203
BBPS-203 Each

Basic Water Purification System BBPS-203

Sign In for Pricing
View Details
Diethyl 2,3-Bis(benzyloxy) Tartrate
TRC-D444855-25MG 25 mg

Diethyl 2,3-Bis(benzyloxy) Tartrate

Sign In for Pricing
View Details