Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51L1 Rabbit Polyclonal Antibody (HRP)

RAD51L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

REC2, R51H2, RAD51L1

UniProt

O15315

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ddn activation kit by CRISPRa
GA201043 1 Kit

Mouse Ddn activation kit by CRISPRa

Sign In for Pricing
View Details
Human NANP activation kit by CRISPRa
GA115418 1 Kit

Human NANP activation kit by CRISPRa

Sign In for Pricing
View Details
4-Aminosalicylic Acid
TRC-A629220-1G 1 g

4-Aminosalicylic Acid

Sign In for Pricing
View Details
Human C20orf166 (MIR1-1HG) activation kit by CRISPRa
GA115062 1 Kit

Human C20orf166 (MIR1-1HG) activation kit by CRISPRa

Sign In for Pricing
View Details
NQO2 (N-term) Rabbit Polyclonal Antibody
AP52927PU-N 400 µL

NQO2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS700799 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details