Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1G2 Rabbit Polyclonal Antibody (FITC)

ATP6V1G2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NG38, ATP6G, VMA10, ATP6G2

UniProt

O95670

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1G2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_569730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C22orf23 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15133R-BF594 100 µL

C22orf23 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Human RRP7BP Protein
E30P7186 20 µg

Recombinant Human RRP7BP Protein

Sign In for Pricing
View Details
Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit
MBS7209543-01 48 Well

Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit

Sign In for Pricing
View Details
Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit
MBS7209543-02 96 Well

Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit

Sign In for Pricing
View Details
Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit
MBS7209543-03 5x 96 Well

Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit

Sign In for Pricing
View Details
Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit
MBS7209543-04 10x 96 Well

Sheep Mediator of RNA polymerase II transcription subunit 4 (MED4) ELISA Kit

Sign In for Pricing
View Details