Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1G2 Rabbit Polyclonal Antibody (HRP)

ATP6V1G2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NG38, ATP6G, VMA10, ATP6G2

UniProt

O95670

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1G2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_569730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (MaxLight 650)
127974-ML650 100 µL

HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (MaxLight 650)

Sign In for Pricing
View Details
PGM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV623097 1.0 µg DNA

PGM3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Polyclonal RSL1D1 Antibody [Janelia Fluor 549]
NBP2-97626JF549 0.1 mL

Rabbit Polyclonal RSL1D1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) ACCD Polyclonal Antibody
MBS7184718 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) ACCD Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD28 Antibody
DL22140F-01 20 Tests

PE/Cyanine5 Anti-Human CD28 Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD28 Antibody
DL22140F-02 50 Tests

PE/Cyanine5 Anti-Human CD28 Antibody

Sign In for Pricing
View Details