Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17D Rabbit Polyclonal Antibody (HRP)

IL17D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL-17D

UniProt

Q8TAD2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL17D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_612141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRFS1 (Ubiquinol-cytochrome C Reductase, Rieske Iron-sulfur Polypeptide 1, RIP1, RIS1, RISP, UQCR5) (MaxLight 405)
MBS6450204-01 0.1 mL

UQCRFS1 (Ubiquinol-cytochrome C Reductase, Rieske Iron-sulfur Polypeptide 1, RIP1, RIS1, RISP, UQCR5) (MaxLight 405)

Sign In for Pricing
View Details
UQCRFS1 (Ubiquinol-cytochrome C Reductase, Rieske Iron-sulfur Polypeptide 1, RIP1, RIS1, RISP, UQCR5) (MaxLight 405)
MBS6450204-02 5x 0.1 mL

UQCRFS1 (Ubiquinol-cytochrome C Reductase, Rieske Iron-sulfur Polypeptide 1, RIP1, RIS1, RISP, UQCR5) (MaxLight 405)

Sign In for Pricing
View Details
Interleukin 12 (IL-12) Human ELISA Kit
E1970 96 Tests

Interleukin 12 (IL-12) Human ELISA Kit

Sign In for Pricing
View Details
Monkey Soluble Collagen ELISA Kit
MBS7278033-01 48 Well

Monkey Soluble Collagen ELISA Kit

Sign In for Pricing
View Details
Monkey Soluble Collagen ELISA Kit
MBS7278033-02 96 Well

Monkey Soluble Collagen ELISA Kit

Sign In for Pricing
View Details
Monkey Soluble Collagen ELISA Kit
MBS7278033-03 5x 96 Well

Monkey Soluble Collagen ELISA Kit

Sign In for Pricing
View Details