Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk10 Rabbit Polyclonal Antibody (Biotin)

Mapk10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Jnk3, SAPb, SAPKC, Serk2

UniProt

B0VXR6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036938

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Neuroligin-4, X-linked ELISA Kit
MBS7279992-01 48 Well

Goat Neuroligin-4, X-linked ELISA Kit

Sign In for Pricing
View Details
Goat Neuroligin-4, X-linked ELISA Kit
MBS7279992-02 96 Well

Goat Neuroligin-4, X-linked ELISA Kit

Sign In for Pricing
View Details
Goat Neuroligin-4, X-linked ELISA Kit
MBS7279992-03 5x 96 Well

Goat Neuroligin-4, X-linked ELISA Kit

Sign In for Pricing
View Details
Goat Neuroligin-4, X-linked ELISA Kit
MBS7279992-04 10x 96 Well

Goat Neuroligin-4, X-linked ELISA Kit

Sign In for Pricing
View Details
Ataxin 7 Rabbit Polyclonal Antibody (PE)
orb498577 100 µL

Ataxin 7 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1)
247044 100 µg

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1)

Sign In for Pricing
View Details