Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB3 Rabbit Polyclonal Antibody (HRP)

ASB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASB-3

UniProt

D6W5B5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_665862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erk1/2 (Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, ERK, Extracellular Signal-regulated Kinase 2, ERK2, ERK-2, ERT1, ERT2, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p42, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, MAPK1, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, MAPK2, Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, MAPK3, p41mapk, p42-MAPK, P42MAPK, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM1, PRKM2, PRKM3) (MaxLight 750) discontinued
E3452-45S-ML750 100 µL

Erk1/2 (Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, ERK, Extracellular Signal-regulated Kinase 2, ERK2, ERK-2, ERT1, ERT2, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p42, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, MAPK1, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, MAPK2, Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, MAPK3, p41mapk, p42-MAPK, P42MAPK, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM1, PRKM2, PRKM3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit
MBS9328498-01 48 Well

Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit

Sign In for Pricing
View Details
Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit
MBS9328498-02 96 Well

Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit

Sign In for Pricing
View Details
Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit
MBS9328498-03 5x 96 Well

Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit

Sign In for Pricing
View Details
Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit
MBS9328498-04 10x 96 Well

Human Lysophospholipid acyltransferase 7, MBOAT7 ELISA Kit

Sign In for Pricing
View Details
Very long chain fatty acid elongase 6 Antibody (Biotin)
orb3165383 100 µg

Very long chain fatty acid elongase 6 Antibody (Biotin)

Sign In for Pricing
View Details