Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NASP Rabbit Polyclonal Antibody (HRP)

NASP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HMDRA1, FLB7527, PRO1999

UniProt

Q5T626

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NASP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_689511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf69 Human shRNA Plasmid Kit (Locus ID 84537)
TL317629 1 Kit

C21orf69 Human shRNA Plasmid Kit (Locus ID 84537)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)
MBS1128944-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)
MBS1128944-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)
MBS1128944-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)
MBS1128944-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)
MBS1128944-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C20G4.09 (SPAC20G4.09)

Sign In for Pricing
View Details