Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE8A Rabbit Polyclonal Antibody (HRP)

PDE8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HsT19550

UniProt

O60658

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PDE8A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002596

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT7 Receptor Antibody
MBS9612082-01 0.1 mL

5HT7 Receptor Antibody

Sign In for Pricing
View Details
5HT7 Receptor Antibody
MBS9612082-02 0.2 mL

5HT7 Receptor Antibody

Sign In for Pricing
View Details
5HT7 Receptor Antibody
MBS9612082-03 5x 0.2 mL

5HT7 Receptor Antibody

Sign In for Pricing
View Details
Human Ras-Related C3 Botulin Toxin Substrate 1 (RAC1) ELISA Kit
MBS167149-01 48 Well

Human Ras-Related C3 Botulin Toxin Substrate 1 (RAC1) ELISA Kit

Sign In for Pricing
View Details
Human Ras-Related C3 Botulin Toxin Substrate 1 (RAC1) ELISA Kit
MBS167149-02 96 Well

Human Ras-Related C3 Botulin Toxin Substrate 1 (RAC1) ELISA Kit

Sign In for Pricing
View Details
Human Ras-Related C3 Botulin Toxin Substrate 1 (RAC1) ELISA Kit
MBS167149-03 5x 96 Well

Human Ras-Related C3 Botulin Toxin Substrate 1 (RAC1) ELISA Kit

Sign In for Pricing
View Details