Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE8A Rabbit Polyclonal Antibody (HRP)

PDE8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HsT19550

UniProt

O60658

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PDE8A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775656

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLL1 Adenovirus (Mouse)
24689054 1.0 mL

IGLL1 Adenovirus (Mouse)

Sign In for Pricing
View Details
TFAP4, CT (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (FITC)
042759-FITC 200 µL

TFAP4, CT (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (FITC)

Sign In for Pricing
View Details
CD40L Rabbit mAb
59400 50 µL

CD40L Rabbit mAb

Sign In for Pricing
View Details
Goat UL16 Binding protein 1 ELISA kit
GTR10406555 96 Well

Goat UL16 Binding protein 1 ELISA kit

Sign In for Pricing
View Details
Olr1535 3'UTR Lenti-reporter-Luc Vector
34014086 1.0 µg

Olr1535 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BCLAF1 Protein Vector (Human) (pPM-C-His)
PV064496 500 ng

BCLAF1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details