Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL47 Rabbit Polyclonal Antibody (FITC)

MRPL47 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NCM1, L47mt, CGI-204, MRP-L47

UniProt

Q9HD33

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL47

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_817125

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pipette Tips 200 μl
PTR00112 1000 / Box

Pipette Tips 200 μl

Sign In for Pricing
View Details
WIPF2, CT (WIPF2, WICH, WIRE, WAS/WASL-interacting protein family member 2, WASP-interacting protein-related protein, WIP- and CR16-homologous protein, WIP-related protein) (PE) discontinued
043879-PE 200 µL

WIPF2, CT (WIPF2, WICH, WIRE, WAS/WASL-interacting protein family member 2, WASP-interacting protein-related protein, WIP- and CR16-homologous protein, WIP-related protein) (PE) discontinued

Sign In for Pricing
View Details
Bovine 39S ribosomal protein L11, mitochondrial (MRPL11) ELISA Kit
OM620048 96 Strip Well

Bovine 39S ribosomal protein L11, mitochondrial (MRPL11) ELISA Kit

Sign In for Pricing
View Details
GNPDA2 Knockout NCI-H1299 Polyclonal Cells
ARG30631 1 Million

GNPDA2 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
(3E,5Z,8Z,11Z,14Z) -Icosapentaenoyl-CoA
HY-CE00127 1 Each

(3E,5Z,8Z,11Z,14Z) -Icosapentaenoyl-CoA

Sign In for Pricing
View Details
Lck, NT (Lck, Lsk-t, Proto-oncogene tyrosine-protein kinase LCK, Leukocyte C-terminal Src kinase, Lymphocyte cell-specific protein-tyrosine kinase, p56-LCK) (PE) discontinued
037711-PE 200 µL

Lck, NT (Lck, Lsk-t, Proto-oncogene tyrosine-protein kinase LCK, Leukocyte C-terminal Src kinase, Lymphocyte cell-specific protein-tyrosine kinase, p56-LCK) (PE) discontinued

Sign In for Pricing
View Details